-
Catalog #
-
AB0018
-
Category
-
Antibodies
-
Family
-
Vesicle Trafficking
-
Source
-
Goat
-
Application
-
WB, IHC (F), IHC (P), IF
-
Reactivity
-
Human, Rat, Mouse, Monkey, Canine
-
Description
-
Goat polyclonal antibody to Rab1b. Rab1b belongs to the small GTPase superfamily, Rab family. Rab1b together with Rab1a control vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.
-
Alternative names
-
RAB1A, RAB1B, RAS-associated protein RAB1A, ras-related protein Rab-1B, ras-related protein Rab-1A, ras-related protein Rab-1B, YPT1 antibody.
-
Gene Identifier/Accession#
-
Gene ID: 81876, ENSG00000174903
-
Form
-
Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
-
Concentration
-
3.00 mg/ml
-
Isotype
-
IgG
-
Clonality
-
Polyclonal
-
Conjugation
-
Unconjugated
-
Immunogen
-
Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli.
-
Antigen Sequence
-
QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC
-
Specificity
-
Detects endogenous levels of Rab1b protein by Western blot in whole cell lysates and transfected cells with GFP-Rab1b cds.
-
Storage
-
Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
-
Special instructions
-
The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
|
Application
|
Values
|
|
WB
|
1:250-1:5,000
|
|
IF
|
1:100-1:500
|
|
IHC (F)
|
1:250-1:1,000
|
|
IHC (P)
|
1:250-1:1,000
|
-
|
Sample
|
WB
|
IHC (F)
|
IHC (P)
|
IF
|
ELISA
|
|
Human
|
+++
|
+++
|
+++
|
+++
|
ND
|
|
Rat
|
+++
|
+++
|
+++
|
+++
|
ND
|
|
Mouse
|
+++
|
+++
|
+++
|
+++
|
ND
|
|
Canine
|
+++
|
+++
|
+++
|
+++
|
ND
|
|
Monkey
|
+++
|
+++
|
+++
|
+++
|
ND
|
-
|
Anti-Rab1b Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
|
|
IHC of human breast carcinoma using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab1b Ab at 1:750/DAB detection;
|
|
Immunofluorescence – anti-Rab1bAb using hCEC cells transduced with GFP-Rab1b; cells were fixed with methanol and anti-Rab5a at 1/250;
|
|
IHC of human pancreas using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab1b Ab at 1:750/DAB detection;
|
|
IHC of rat lung using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab1b Ab at 1:750/DAB detection;
|