Anti-Rab27a

(0) Reviews

(5) References

(0) Validations

(0) Q&A

Catalog #: AB0023
Category: Antibodies
Family: Vesicle Trafficking
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to mouse Rab27a. Rab27a belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in lysosome-related vesicle transport and small GTPase mediated signal transduction.
Alternative names: GS2, GTP-binding protein Ram, rab-27, ras-related protein Rab-27A, RAB27, RAM.
Gene Identifier/Accession#: ENSG00000069974, Gene ID: 5873
Form: Polyclonal antibody supplied as a 200 or 500 µl (1 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 1.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.
Antigen Sequence: MHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC
Specificity: Detects Rab27a by Western blot in the following human, rat and mouse whole cell lysates and transfected cells with GFP-Rab27a. This antibody also recognizes Rab27b protein.
Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:250-1:2,000
IF	1:50-1:200
IHC (P)	1:50-1:400
IHC (F)	1:50-1:400

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (5)

Reichhart N, Markowski M, Ishiyama S et al. Cell Signal 2015 Jul	PMID: 26235199
Pelkonen L, Reinisalo M, Morin-Picardat E et al. PLoS One 2016 Aug	PMID: 27551967
Sanzà P, Evans RD, Briggs DA, et al. J Cell Sci 2019 Apr	PMID: 30898842
Ramsay E, Raviña M, Sarkhel S, et al. Pharmaceutics 2020 Jul	PMID: 32708811
Alzahofi N, Welz T, Robinson CL, et al. Nat Commun. 2020 Jul	PMID: 32661310

Images

	Anti-Rab27a antibody IHC staining of mammary tissue; Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; Antibody concentration 1/200;
	Anti-Rab27a antibody IHC staining of albino mouse retina; Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; Antibody concentration 1/200;
	Anti-Rab27 antibody at 1/500 dilution; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;