Anti-Rab11a

(0) Reviews

(1) References

(0) Validations

(0) Q&A

Catalog #: AB0034
Category: Antibodies
Family: Vesicle Trafficking
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to mouse Rab11a. Rab11a belongs to the small ATPase superfamily, Rab family. The protein is membrane-bound and plays essential roles in vesicle and granule targeting. Similar to Rab11b, it has been shown that Rab11a associates with recycling endosomes.
Alternative names: MGC1490, Rab11, RAB11A member RAS oncogene family, RB11A, YL8 antibody.
Gene Identifier/Accession#: ENSG00000103769, Gene ID: 8766
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of mouse Rab11a produced in E. coli.
Antigen Sequence: MRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
Specificity: Detects a band of 24 kDa by Western blot in the following human, rat and mouse whole cell lysates and transfected cells with GFP-Rab11a cds. This antibody is specific to Rab11a. It does not recognize Rab11b.
Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:250-1:2,000
IF	1:50-1:250
IHC (P)	1:100-1:400
IHC (F)	1:100-1:400

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (1)

Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018

Images

	Immunofluorescence – anti-Rab11a Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin;
	Anti-Rab11a antibody IHC staining of human mammary tissue; immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; antibody concentration 1/200;
	Anti-Rab11a Ab at 1/2,500 dilution; lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;