Anti-Rab32
- Catalog #
- AB0036
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB, IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Rab32. Rab32 belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in intracellular vesicle transport and small GTPase mediated signal transduction.
- Alternative names
- N/A
- Gene Identifier/Accession#
- ENSG00000118508, Gene ID: 10981
- Form
- Polyclonal antibody supplied as a 200 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 4.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.
- Antigen Sequence
- KNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENMLANQQSFPSEEIDLDRIKLVEEPPTTKPRSQCC
- Specificity
- Detects an endogenous band by Western blot in Melan-ink, XB2 and 3T3 cell line lysates (approximately 30 kDa) and in transfected cells with GFP-Rab32 cds.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 IF 1:100-1:500 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND +++ ND Rat +++ ND ND +++ ND Mouse +++ ND ND +++ ND Canine +++ ND ND +++ ND Monkey +++ ND ND +++ ND -
Immunostaining of primary RPE cells with Rab32 Ab; 
Endogeneous Rab32 protein detected with anti-Rab32 polyclonal Ab at 1/500 dilution; lysate at 100 µg per lane;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
800 µg
Add to shopping cart
Shipping
No Shipping