Anti-mCherry
- Catalog #
- AB0040
- Category
- Antibodies
- Family
- Fluorescent Proteins
- Source
- Goat
- Application
- WB, IHC (F), IHC (P), IF, IEM
- Reactivity
- Transfected cells
- Description
- Goat polyclonal antibody to mCherry (Cherry fluorescent protein).
- Alternative names
- Cherry fluorescent protein, dsRed, red fluorescent protein, tdTomato antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide produced in E. coli.
- Antigen Sequence
- MTMITPSLHACRSTLEDPRVPVATMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
- Specificity
- In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody recognizes very well tdTomato and does not recognize GFP (green fluorescent protein).
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:5,000 IF 1:50-1:500 IHC (P) 1:50-1:500 IHC (F) 1:50-1:500 IEM 1:50-1:500 -
Sample WB IHC (F) IHC (P) IF ELISA IEM Transfected cells +++ +++ +++ +++ ND +++ -
-
Immunofluorescence – anti-mCherry Ab using MCR cells transduced with mCherry-Rab11a; cells were fixed with methanol and anti-Rab11a at 1/250; 
Anti-mCherry Ab at 1/1,000 dilution; 293 cells transfected with myc-mCherry; 
Immunofluorescence in Drosophila larvae NMJ muscle 6/7 expressing mCherry in neurons (DyGlutmcherry) using 1st Ab anti-mCherry at 1/1,000 and 2nd Ab anti-goat IgY conjugated to DyLight®488 at 1/500; 
Immunogold labeling of RPE, in vivo injected with mCherry expressing vector; 
293 HEK cells transduced with Ad mCherry Rab1a and stained with anti-mCherry; 
Anti-mCherry Ab in COS-7 cells transfected with mCherry-EEA1 at 1/100 dilution; 
Immunofluorescence – anti-mCherry Ab using hCEC cells transduced with mCherry-Rab11a; cells were fixed with methanol and anti-Ra11a at 1/250;
Usage
Reactivity Chart
External References (113)
Images
320 €
Quantity / Unit Size
600 µg
1.5 mg
Add to shopping cart
Shipping
No Shipping