Anti-UIS4

(0) Reviews

(26) References

(0) Validations

(0) Q&A

Catalog #: AB0042
Category: Antibodies
Family: Malaria
Source: Goat
Application: IF
Reactivity: Plasmodium
Description: Goat polyclonal antibody to UIS4. UIS4 protein is expressed throughout liver stage development and localizes to the parasite vacuole (parasitophorous vacuole membrane).
Alternative names: N/A
Gene Identifier/Accession#: Gene ID: 3925517
Form: Polyclonal antibody supplied as a 200 or 500 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 2.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 80 aa to the C-terminus of UIS4 produced in E. coli.
Antigen Sequence: MNPEVREKFRIGKRIKEFDDVNTPQDISLINPVENPYPENSPENSPENSPEKYIEESHKHYTKRFLEQYTEPKPSDHTYSYSPTEEAYNTHYMASDTHEDYGKLFTDEHKDEINDNIVYHDELSDLVGEGNNVYNMENKSFGPYI
Specificity: Detects UIS4 in Plasmodium berghei
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
IF	1:250-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Plasmodium	ND	ND	ND	+++	ND

External References (26)

McLellan JL, Sausman W, Reers AB, et al. mSphere 2023 Dec	PMID: 37909773
Mitchell G, Torres L, Fishbaugher ME, et al. Malar J 2024 Feb	PMID: 38383417
Fernandes P, Loubens M, Marinach C, et al. iScience 2023 Jan	PMID: 36761022
Matos CTSM, PhD Thesis, Universidade NOVA de Lisboa, Portugal 2013
Thieleke-Matos C, Lopes da Silva M, Cabrita-Santos L, et al. Traffic 2014 Oct	PMID: 24992508
Thieleke-Matos C, Lopes da Silva M, Cabrita-Santos L, et al. Cellular Microbiology 2015 Sep	PMID: 26399761
Risco-Castillo V, Topcu S, Marinach C, et al. Cell Host & Microbe 2015	PMID: 26607162
Silva PA, Guerreiro A, Santos JM. PLoS One 2016 Jan	PMID: 26808677
Manzoni G, Marinach C, Topçu S, et al. Elife 2017 May	PMID: 28506360
Santos JM, Egarter S, Zuzarte-Luís V, et al. Elife 2017 May	PMID: 28525314

Images

	UIS4 liver section: 50 µM liver sections of a B6 mice infected with Plasmodium Berghei ANKA parasites (44 hours post infection), stained with anti-UIS4 (1:500 in red) followed by Alexa anti goat 568 (1:400) and nuclei (blue).
	UIS4 liver section: 50 µM liver sections of a B6 mice infected with Plasmodium Berghei parasites, stained with anti-UIS4 (1:500) followed by Alexa anti-goat 466 (1:400) and nuclei (blue).