Anti-Cathepsin D

(0) Reviews

(3) References

(0) Validations

(0) Q&A

Catalog #: AB0043
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IHC (F), IHC (P), IF, IEM
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to Cathepsin D. Cathepsin D is a lysosomal aspartic protease of the pepsin family. Acid protease active in intracellular protein breakdown. It is composed of a dimer of disulphide-linked heavy and light chains, both produced from a single protein precursor. It is involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Alternative names: ceroid-lipofuscinosis, CLN10; CPSD, CTSD, lysosomal aspartyl protease, lysosomal aspartyl peptidase, neuronal 10 antibody.
Gene Identifier/Accession#: Gene ID: 1509, ENSG00000117984
Form: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli.
Antigen Sequence: DQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Specificity: This antibody gives a positive signal in the following human (Jurkat, HT1080, HUH, MDA-MB-231, ARPE19, SH-SY5Y), canine (MDCK) and monkey (COS-7) whole cell lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:250-1:1,000
IF	1:50-1:200
IHC (P)	1:200-1:1,000
IHC (F)	1:200-1:1,000
IEM	1:50-1:200

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA	IEM
Human	+++	+++	+++	+++	ND	+++
Rat	+++	+++	+++	+++	ND	+++
Mouse	+++	+++	+++	+++	ND	+++
Canine	+++	+++	+++	+++	ND	+++
Monkey	+++	+++	+++	+++	ND	+++

External References (3)

Alves LS, Marques ARA, Padrao N, et al. J Cell Sci 2021 Sep	PMID: 34528688
Pelkonen L, Sato K, Reinisalo M, et al. Mol Pharm 2017 Mar.	PMID: 28112518
Romagnoli M, Bresson L, Di-Cicco A, et al. Development 2020 Jan.	PMID: 31988184

Images

	Immunofluorescence – anti-CTSD Ab at 1/100 dilution in RAW264.7 cells; cells were fixed with PFA and permeabilized with 0.05% saponin;
	Anti-CTSD Ab at 1/500 dilution; endogenous CTSD (50 µg per lane); rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunogold labeling using melanocytes and anti-CTSD Ab;
	IHC of mouse spleen using anti-CTSD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTSD Ab at 1:500/DAB detection.
	Immunofluorescence – anti-CTSD Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin;
	IHC of mouse lung using anti-CTSD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTSD Ab at 1:500/DAB detection.
	Immunoperoxidase of polyclonal antibody to CTSD (1/200) on paraformaldehyde-fixed paraffin-embedded mouse lung;
	Anti-CTSD Ab at 1/500 dilution; endogenous CTSD (100 µg per lane) and transfected 293FT cell lysate (at 30 µg per lane); rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse brain using anti-CTSD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTSD Ab at 1:500/DAB detection.
	IHC of mouse stomach using anti-CTSD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTSD Ab at 1:500/DAB detection.
	IHC of mouse eye using anti-CTSD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CTSD Ab at 1:500/DAB detection.