Anti-CDH1
- Catalog #
- AB0057
- Category
- Antibodies
- Family
- Organelle Markers
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal to CDH1. CDH1 is a classical member of the cadherin superfamily. This protein is a calcium dependent cell-cell adhesion glycoprotein comprised consists of 5 cadherin repeats in the extracellular domain, one trans membrane domain, and a and a highly conserved intracellular domain that binds b-catenin and p120-catenin. CDH1 is involved in mechanisms regulating proliferation, mobility and cell-cell adhesions of epithelial cells. Loss of E-cadherin function or expression has been implicated in cancer metastasis and progression.
- Alternative names
- ARC-1, CAM 120/80, CD324, CDH1, cdhc-A, CDHE, ECAD, E-Cad E-cadherin, Epithelial cadherin, l-cam, LCAM, P09803, P12830 / Q9R0T4, UVO, Uvomorulin, XBcad, XB-cadherin, XTCAD-1 antibody.
- Gene Identifier/Accession#
- Gene ID: 999, ENSG00000039068
- Form
- Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli.
- Antigen Sequence
- YYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSL
- Specificity
- Detects endogenous levels of total E-cadherin protein by Western blot in the whole cell lysates (COS-7 and MDCK).
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 IHC (F) 1:250-1;1:000 IHC (P) 1:250-1;1:000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of human appendix using anti-CDH1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CDH1 Ab at 1:500/DAB detection. 
Endogenous CDH1 detected at 1/500 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution. 
IHC of mouse lung using anti CDH1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CDH1 Ab at 1:500/DAB detection. 
IHC of mouse liver using anti-CDH1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CDH1 Ab at 1:500/DAB detection. 
IHC of human myocardium using anti-CDH1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CDH1 Ab at 1:500/DAB detection.
Usage
Reactivity Chart
Images
300 €
Quantity / Unit Size
400 µg
Add to shopping cart
Shipping
No Shipping