Anti-STX6
- Catalog #
- AB0058
- Category
- Antibodies
- Family
- Organelle Markers
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal to Syntaxin-6 – trans-Golgi and endosome marker. This trans-Golgi and endosome protein regulates membrane trafficking by partnering with a variety of other SNARE proteins. This protein is also involved in the regulation of neutrophil exocytosis, granule secretion and GLUT4 trafficking.
- Alternative names
- Syn6 and STX6 antibody.
- Gene Identifier/Accession#
- ENSG00000135823, Gene ID: 10228
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli.
- Antigen Sequence
- MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDAT
- Specificity
- Detects STX6 by Western blot in transfected cells with GFP-STX6.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Canine +++ ND ND ND ND Monkey +++ ND ND ND ND -
Anti-STX6 Ab at 1/500 dilution; lysates at 30 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
300 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping