Anti-Clathrin HC

(0) Reviews

(2) References

(0) Validations

(0) Q&A

Catalog #: AB0059
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to Clathrin Heavy Chain. Clathrin is formed by three clathrin heavy chains and three light chains. This protein is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in endocytosis of a variety of macromolecules and in the intracellular trafficking of receptors.
Alternative names: clathrin, clathrin heavy chain 1, clathrin heavy polypeptide (Hc), clathrin heavy polypeptide-like 2, CLTC, CHC17, CLH-17, CLTCL2, Hc, heavy chain (Hc) antibody.
Gene Identifier/Accession#: Gene ID: 1213, ENSG00000141367
Form: Polyclonal antibody supplied as a 200 μl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum
Concentration: 2.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 50 aa to N-terminus of human CLTC produced in E. coli.
Antigen Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVII
Specificity: Detects endogenous levels of total CLTC by Western blot in the whole cell lysates (MDCK, At-T20, COS-7).
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:250-1:1,000
IF	1:25-1:250

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	ND	ND	+++	ND
Rat	+++	ND	ND	+++	ND
Mouse	+++	ND	ND	+++	ND
Canine	+++	ND	ND	+++	ND
Monkey	+++	ND	ND	+++	ND

External References (2)

Caì Y, Postnikova EN, Bernbaum JG, et al. J Virol. 2015 Jan 1;89(1):844-56.	PMID: 25355889
Imbastari F, PhD Thesis, Humboldt-Universität zu Berlin, Germany 2020

Images

	Immunofluorescence – anti-CLTC Ab – Membrane Vesicle Marker in Hepa1-6 cells at 1/50 dilution; cells were fixed with methanol;
	Immunofluorescence – anti-CLTC Ab – Membrane Vesicle Marker in Hepa1-6 cells at 1/50 dilution; cells were fixed with methanol;
	Endogenous CLTC detected with at 1/500 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;