Anti-VEGFA

(0) Reviews

(6) References

(0) Validations

(0) Q&A

Catalog #: AB0063
Category: Antibodies
Family: Growth Factors and Cytokines
Source: Goat
Application: WB, IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to VEGFA. This protein is a member of the PDGF/VEGF growth factor family. It is a glycosylated mitogen that specifically acts on endothelial cells and has various effects such as mediating increased vascular permeability, endothelial cell growth, promoting cell migration, inducing angiogenesis and inhibiting apoptosis.
Alternative names: MVCD1, RP1-261G23.1, VEGF, vascular permeability factor and VPF antibody.
Gene Identifier/Accession#: Gene ID: 7422, ENSG00000112715
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant human VEGFA isoform 6 produced in E. coli.
Antigen Sequence: MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Specificity: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:250-1:2,000
IF	1:50-1:250

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	ND	ND	+++	ND
Rat	+++	ND	ND	+++	ND
Mouse	+++	ND	ND	+++	ND
Canine	+++	ND	ND	+++	ND
Monkey	+++	ND	ND	+++	ND

External References (6)

Rodrigues T, Matafome P, Sereno J, et al. Sci Rep. 2017 May	PMID: 28490763
Fonseca LMO, MSc Thesis, University of Berlin, Portugal 2018
Rodrigues TDA, PhD Thesis, University of Coimbra, Portugal, 2018
Rodrigues T, Borges P, Mar L, et al. Pharmacol Res. 2020 Sep.	PMID: 32942016
2. Oliveira SF, MSc Thesis, University of Coimbra, Portugal, 2019
1. Martinho JM, Coelho A, Oliveiros B, et al. Int Endod J 2021 May	PMID: 33999433

Images

	MBP-VEGFA isoform 6 recombinant protein detected by WB using anti-VEGFA Ab at 1,000 dilution; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunostaining of primary RPE cells using VEGFA Ab at 1/50 dilution;