Anti-GFP

(0) Reviews

(31) References

(0) Validations

(0) Q&A

Catalog #: AB0066
Category: Antibodies
Family: Fluorescent Proteins
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Transfected cells
Description: Goat polyclonal antibody to GFP (green fluorescent protein). GFP is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to blue light. In cell and molecular biology, the GFP protein is frequently used as a reporter of expression.
Alternative names: Green fluorescent protein antibody.
Gene Identifier/Accession#: N/A
Form: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide produced in E. coli.
Antigen Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Specificity: In 293HEK cells transfected with cds plasmid detects a band of 27 kDa by Western blot. This antibody does not recognize mCherry fluorescent protein.
Storage: For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:5,000
IF	1:50-1:1,000
IHC (P)	1:50-1:1,000
IHC (F)	1:50-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Transfected cells	+++	+++	+++	+++	ND

External References (31)

Ebrahimi S, Eini O, Baßler A, et al. Viruses 2023 Sep	PMID: 37896771
Stüfchen I, Beyer F, Staebler S, et al. iScience 2023 May	PMID: 37283806
Koukiali A, Daniilidou M, Mylonis I, et al. Cells Cells 2022 Dec	PMID: 36611919
Moreiras HAF, MSc Thesis, University of Lisbon, Portugal, 2014
Issa JB, Haeffele BD, Agarwal A, et al. Neuron 2014 Aug (Supplemental Information)	PMID: 25088366
Sargiannidou I, Kim GH, Kyriakoudi S, et al. Neurogenetics 2015 Mar	PMID: 25771809
Bugalhão JN, Mota LJ, Franco IS. Microbiologyopen 2015 Dec	PMID: 26626407
Roux I, Wu JS, McIntosh JM, et al. J Neurophysiol 2016 Apr	PMID: 27098031
Carneiro L, Geller S, Fioramonti X, et al. Am J Physiol Endocrinol Metab 2016 Jan	PMID: 26530151
Zhang-Hooks Y, Agarwal A, Mishina M, et al. Neuron 2016 Jan (Supplemental Information).	PMID: 26774161

Images

	Hepa1-6 transfected with GFP-Rab1a and immunostained with with GFP Ab;
	Anti-GFP Ab at 1/2,000 dilution; transfected 293HEK cell lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence in Drosophila larvae NMJ muscle 6/7 expressing GluRIIA-GFP in neurons (GluRIIA ia a post-synaptic protein) using 1st Ab anti-GFP at 1/1,000 and 2nd Ab anti-goat IgY conjugated to DyLight®550 at 1/500;