Anti-HTT
- Catalog #
- AB0080
- Category
- Antibodies
- Family
- Neurobiology
- Source
- Goat
- Application
- WB, IHC (F), IHC (P), IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Huntingtin is a protein linked to Huntington's disease, a neurodegenerative disorder characterized by loss of striatal neurons.
- Alternative names
- HD, HTT and IT15 antibody.
- Gene Identifier/Accession#
- ENSG00000197386, Gene ID: 3064
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli
- Antigen Sequence
- PLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAEL
- Specificity
- Reacts huntingtin protein, amino acids 85-200. The antibody recognizes wild type and mutant huntingtin.
- Storage
- For continuous use, store at 2-8 deg;C for one-two days. For extended storage, store in -20 deg;C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IF 1:500-1:2,000 IHC (P) 1:500-1:2,000 IHC (F) 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ +++ ND Rat +++ +++ +++ +++ ND Mouse +++ +++ +++ +++ ND Canine +++ +++ +++ +++ ND Monkey +++ +++ +++ +++ ND -
Rat LV-Htt171-82Q (800 ng), PFA 4%, HTT Ab, 1/2,000 PBS-BSA 1% – 25µm; 
Rat LV-Htt171-82Q (800 ng), PFA 4%, HTT Ab, 1/2,000 PBS-BSA 1% – 25µm;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping