Anti-LMNA

(0) Reviews

(0) References

(0) Validations

(0) Q&A

Catalog #: AB0093
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to LMNA (Lamin A/C) - nucleus marker. The Lamin family of proteins make up the matrix of proteins located next to the inner nuclear membrane. During mitosis, the lamina matrix is reversibly disassembled as the Lamin proteins are phosphorylated. These proteins are thought to be involved in chromatin structure, nuclear stability and gene expression.
Alternative names: CDDC, CDCD1, CMD1A, CMT2B1, EMD2, FPL, FPLD, FPLD2 HGPS, IDC, LDP1, LFP, LGMD1B, LMNC, LMN1, LMNL1, PRO1 antibody.
Gene Identifier/Accession#: Gene ID: 4000, ENSG00000160789
Form: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide within residues 620 aa to C-term of human LMNA produced in E. coli.
Antigen Sequence: SASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM
Specificity: Detects a band of 65-70 kDa by Western blot in whole cell lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:5,000
IF	1:100-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	ND	ND	+++	ND
Rat	+++	ND	ND	+++	ND
Mouse	+++	ND	ND	+++	ND
Canine	+++	ND	ND	+++	ND
Monkey	+++	ND	ND	+++	ND

Images

	Immunofluorescence –anti-LMNA Ab using COS-7 cells; cells were fixed with methanol and anti-LMNA at 1/250;
	Anti-LMNA Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence –anti-LMNA Ab using hCEC cells; cells were fixed with methanol and anti-LMNA at 1/100;
	Immunofluorescence –anti-LMNA Ab using hCEC cells; cells were fixed with methanol and anti-LMNA at 1/100;