Anti-CD19
- Catalog #
- AB0097
- Category
- Antibodies
- Family
- CD Markers
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to CD19. CD19 is a type I transmembrane glycoprotein with 2 C-type Ig domains and multiple phosphorylation sites on long cytoplasmic domain. It is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. It is a major B lineage marker.
- Alternative names
- B4, Bgp95, B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, CVID3, differentiation antigen CD19, T-cell surface antigen Leu-12 antibody.
- Gene Identifier/Accession#
- Gene ID: 930, ENSG00000177455
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli.
- Antigen Sequence
- YAAPQLRSIRGQPGPNHEEDADSYENMDNPDGPDPAWGGGGRMGTWSTR
- Specificity
- Using spleen and Jurkat cell lysates detects a 95 kDa band by Western blot. This Ab is similar to AB1097.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of human appendix using anti-CD19 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD19 Ab at 1:750/DAB detection; 
Endogenous CD19 detected with at 1/500 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of mouse kidney using anti-CD19 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD19 Ab at 1:750/DAB detection; 
IHC of mouse liver using anti-CD19 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD19 Ab at 1:750/DAB detection; 
IHC of human lymph node using anti-CD19 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD19 Ab at 1:750/DAB detection; 
IHC of mouse spleen using anti-CD19 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CD19 Ab at 1:750/DAB detection;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping