Anti-GroEL
- Catalog #
- AB0130
- Category
- Antibodies
- Family
- Bacteria
- Source
- Goat
- Application
- WB
- Reactivity
- Bacteria
- Description
- Goat polyclonal antibody to GroEL. GroEL protein is a 60 kDa chaperone that promotes refolding of misfolded polypeptides especially under stressful conditions.
- Alternative names
- chaperonin GroEL protein antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 400 aa to the C-terminus of Burkholderia GroEL produced in E. coli.
- Antigen Sequence
- DALHATRAAVEEGIVAGGGVALIRARTAIAGLTGANADQNAGIKIVLRAMEEPLRQIVTNGGEEASVVVAAVAAGKGNYGYNAATGEYVD
- Specificity
- The Ab recognizes the endogenous protein in Burkholderia and Pseudomonas by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 -
Sample WB IHC (F) IHC (P) IF ELISA Bacteria +++ ND ND ND ND -
Anti-GroEL Ab at 1/2,500 dilution; 50-100 µg of total protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping