Anti-FTCD
- Catalog #
- AB0160
- Category
- Antibodies
- Family
- Organelle Markers
- Source
- Goat
- Application
- WB, IHC (F), IHC (P), IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal to formimidoyltransferase cyclodeaminase (FTCD) - Golgi complex marker. This protein is a bifunctional enzyme that plays important roles in coupling histidine catabolism with folate metabolism. It binds and promotes bundling of vimentin filaments originating from the Golgi. Diseases such as glutamate formiminotransferase deficiency and autoimmune hepatitis have been associated to this enzyme.
- Alternative names
- 58K Golgi protein, Formimidoyltransferase Cyclodeaminase, LCHC antibody.
- Gene Identifier/Accession#
- Gene ID: 10841, ENSG00000160282
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 50 aa to the N-terminus of human FTCD produced in E. coli.
- Antigen Sequence
- MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPP
- Specificity
- Detects a band of 55-60 kDa by Western blot in the following canine, human, monkey, mouse, rat whole cell lysates.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IF 1:25-1:250 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ +++ ND Rat +++ +++ +++ +++ ND Mouse +++ +++ +++ +++ ND Canine +++ +++ +++ +++ ND Monkey +++ +++ +++ +++ ND -
Immunofluorescence – anti-FTCD Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin; 
IHC of human pancreas using anti-FTCD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-FTCD Ab at 1:750/DAB detection. 
IHC of mouse kidney using anti-FTCD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-FTCD Ab at 1:750/DAB detection. 
Immunofluorescence – anti-FTCD Ab at 1/100 dilution in NHI/3T3 cells; cells were fixed with methanol and permeabilized with 0.1% saponin; 
IHC of mouse liver using anti-FTCD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-FTCD Ab at 1:750/DAB detection. 
Immunofluorescence – anti-FTCD Ab at 1/100 dilution; cells were fixed with methanol and permeabilized with 0.1% saponin; 
IHC of mouse testis using anti-FTCD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-FTCD Ab at 1:750/DAB detection. 
Immunofluorescence – anti-FTCD Ab at 1/100 dilution; cells were fixed with methanol and permeabilized with 0.1% saponin; 
IHC of human skin using anti-FTCD antibody and FFPE tissue after heat-induced antigen retrieval. Anti-FTCD Ab at 1:750/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping