Anti-INSR
- Catalog #
- AB0162
- Category
- Antibodies
- Family
- CD Markers
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to insulin receptor. INSR is a receptor tyrosine kinase. Preprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. The insulin signalling pathway, which regulates glucose uptake and release, as well as the synthesis and storage of carbohydrates, lipids and protein is activated by the binding of insulin or other ligands to this receptor.
- Alternative names
- CD220, HHF5, insulin receptor antibody.
- Gene Identifier/Accession#
- Gene ID: 3643, ENSG00000171105
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli.
- Antigen Sequence
- KAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS
- Specificity
- Using liver, HeLa and Skov3 cell lysates detects a 180 kDa band by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse kidney using anti-INSR antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INSR Ab at 1:750/DAB detection. 
Endogenous INSR detected at 1/2,500 dilution; lysate at 50 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution. 
IHC of human placenta using anti-INSR antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INSR Ab at 1:750/DAB detection. 
IHC of mouse retina using anti-INSR antibody and FFPE tissue after heat-induced antigen retrieval. Anti-INSR Ab at 1:750/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping