Anti-GFAP
- Catalog #
- AB0165
- Category
- Antibodies
- Family
- Structural proteins
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey
- Description
- Goat polyclonal antibody to GFAP. Glial fibrillary acidic protein is a major intermediate filament protein of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development.
- Alternative names
- ALXDRD, glial fibrillary acidic protein antibody.
- Gene Identifier/Accession#
- Gene ID: 2670, ENSG00000131095
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antise
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 375 aa to the C-terminus of human GFAP produced in E. coli.
- Antigen Sequence
- ENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM
- Specificity
- Detects endogenous levels of GFAP by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Monkey +++ ND ND ND ND -
Anti-GFAP Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping