Anti-ARD1
- Catalog #
- AB0276
- Category
- Antibodies
- Family
- Insect
- Source
- Goat
- Application
- WB
- Reactivity
- Archeoprepona
- Description
- Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.
- Alternative names
- Heliomycin, ETD135, ETD151 antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant defensin ARD1 produced in E. coli
- Antigen Sequence
- MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET
- Specificity
- Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Archeoprepona +++ ND ND ND ND -
Anti-Ard1 Ab at 1:2,500 dilution; 50 ng of protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
200 µg
Add to shopping cart
Shipping
No Shipping