Anti-SNCB
- Catalog #
- AB0285
- Category
- Antibodies
- Family
- Neurobiology
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to SNCB. Beta-Synuclein is a member of Synuclein family which includes alpha and gamma. SNCB inhibits phospholipase D2 and may function in neuronal plasticity. It is a non-amyloid component of senile plaques found in Alzheimer disease and can act as a regulator of SNCA aggregation process.
- Alternative names
- Beta-Synuclein, Synuclein Beta antibody.
- Gene Identifier/Accession#
- Gene ID: 6620
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 80 aa to the C-terminus of human SNCB produced in E. coli.
- Antigen Sequence
- SRETGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
- Specificity
- Detects endogenous levels of SNCB by Western blot. This Ab is specific for SNCB and does not recognizes SNCA and SNCG proteins.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:5,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Canine +++ ND ND ND ND Monkey +++ ND ND ND ND -
Anti-SNCB Ab at 1/1,000 dilution; mouse brain lysate at 50 µg per lane; chicken polyclonal to goat IgG (HRP) at 1/10,000 dilution.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
200 µg
Add to shopping cart
Shipping
No Shipping