Anti-HIS Epitope
- Catalog #
- AB0294
- Category
- Antibodies
- Family
- TAG-Antibodies
- Source
- Goat
- Application
- None
- Reactivity
- Transfected cells, Transformed cells, Recombinant protein
- Description
- Goat polyclonal antibody to HIS epitope. The HHHHHH epitope is used as a tag on many recombinant proteins to facilitate purification. The antibody recognizes the His-tag fused to the amino- or carboxy- termini of targeted proteins in transformed or transfected cells.
- Alternative names
- 6xHis-Tag®, HIS6 Tag, His Tag, HHHHHH Tag, antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide produced in E. coli.
- Antigen Sequence
- MHHHHHHHHHHNPMHHHHHHHHHHNPMHHHHHHHHHHNPMHHHHHHHHHHNPMHHHHHHHHHHNPGCDGDGDGDGDALGIPGIHAEPDPILEDGRHHQTWLASPAKAMLYTCWISSTYQFVG
- Specificity
- The antibody recognizes the His-tag fused to the amino- or carboxy- termini of targeted proteins in transformed or transfected cells.
- Storage
- Store at -20 C for long term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Sample WB IHC (F) IHC (P) IF ELISA IEM Transfected cells +++ ND ND ND ND ND Transformed cells +++ ND ND ND ND ND Recombinant protein +++ -
Anti-HIS Ab at 1/2,000 dilution; protein lysates at 50 ng per lane; chicken polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping