Anti-ITGB2
- Catalog #
- AB0313
- Category
- Antibodies
- Family
- Organelle Markers
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to ITGB2. The integrin beta chain combined with multiple different alpha chains form different integrin heterodimers. Integrins are integral cell-surface proteins that act as cell-surface mediated signaling and participate in cell adhesion.
- Alternative names
- CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7 antibody
- Gene Identifier/Accession#
- Gene ID: 3689
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 140 aa to the N-terminus of human ITGB2 produced in E. coli.
- Antigen Sequence
- MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQED HNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLS
- Specificity
- Detects endogenous levels of ITGB2 using Jurkat cell line by Western blot.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Monkey +++ ND ND ND ND Canine +++ ND ND ND ND -
Anti-ITGB2 Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping