Anti-ADORA2A
- Catalog #
- AB0318
- Category
- Antibodies
- Family
- Neurobiology
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to ADORA2A. It is a member of the guanine nucleotide binding coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular stimuli and activate intracellular signal transduction pathways. It plays an important role in many biological functions, including cerebral and renal blood flow, immune function, cardiac rhythm and circulation, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as neurodegenerative and inflammatory disorders.
- Alternative names
- A2aR, ADORA2, RDC8 antibody.
- Gene Identifier/Accession#
- Gene ID: 135, ENSG00000128271
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 360 aa to the C-terminus of human ADORA2A produced in E. coli.
- Antigen Sequence
- YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
- Specificity
- Detects endogenous levels of ADORA2A in brain by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of mouse brain using anti-ADORA2A antibody and FFPE tissue after heat-induced antigen retrieval. anti-ADORA2A Ab at 1:500/DAB detection. 
Anti-ADORA2A Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human appendix using anti-ADORA2A antibody and FFPE tissue after heat-induced antigen retrieval. anti-ADORA2A Ab at 1:500/DAB detection. 
IHC of mouse liver using anti-ADORA2A antibody and FFPE tissue after heat-induced antigen retrieval. anti-ADORA2A Ab at 1:500/DAB detection. 
IHC of mouse stomach using anti-ADORA2A antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ADORA2A Ab at 1:500/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping