Anti-HSP20
- Catalog #
- AB0348
- Category
- Antibodies
- Family
- Malaria
- Source
- Goat
- Application
- WB
- Reactivity
- Plasmodium
- Description
- HSP20, a heat shock protein, that plays a role in in cell traction and Plasmodium motility.
- Alternative names
- Small heat shock protein antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Affinity purified recombinant fusion protein HSP20 from Plasmodium and produced in E. coli.
- Antigen Sequence
- MSCLCAGCGDKGEIKITPDHRINIKEKQSVPKNKNTLVNPNTVLEIMPDKNLKKQITFRPKVDIMYDSESCHAILVLDIPGFKIDDIDVEIGEGMLTIAGPRSQTELFETYGDNLVLHAKEREVGYFKRIFKLPHNILDDTAHAVYKNGILEIKMECKQFSYMHKVEINEA
- Specificity
- In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA IEM Plasmodium +++ ND ND ND ND ND -
Anti-HSP20 Ab at 1:2,000 dilution; 30 ng of protein per lane; chicken polyclonal to goat IgG conjugated to HRP (AB1125) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
350 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping