Anti-ORF3a (SARS-CoV-2)
- Catalog #
- AB0372
- Category
- Antibodies
- Family
- SARS-CoV-2 Virus
- Source
- Goat
- Application
- WB
- Reactivity
- Transfected cells
- Description
- ORF3a encodes a viral accessory and uncharacterised protein with possible role in the viral life cycle. Six functional domains have been identified and have linked to infectivity, virulence, ion channel formation and virus release.
- Alternative names
- ORF3a SARS Coronavirus-2 antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Affinity purified fusion recombinant protein using the C-terminal of ORF3a (residues 160 to stop) and produced in E. coli.
- Antigen Sequence
- MNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
- Specificity
- In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Transfected cells +++ ND ND ND ND -
Anti-ORF3a Ab at 1/2,500 dilution using HEK293 transfected cell lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping