Anti-ORF7a (SARS-CoV-2)
- Catalog #
- AB0379
- Category
- Antibodies
- Family
- SARS-CoV-2 Virus
- Source
- Goat
- Application
- WB
- Reactivity
- Transfected cells
- Description
- ORF7a is a SARS-CoV accessory protein that is composed of a type I transmembrane protein that localizes primarily to the Golgi apparatus and also be found on the cell surface. This protein has been implicated on several mechanisms such as suppressing both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA (siRNA), attachment and modulation of leukocytes by biding to host ITGAL and playing a role as antagonist of host tetherin (BST2) by disrupting its antiviral effect.
- Alternative names
- ORF7a SARS Coronavirus-2 antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Affinity purified recombinant fusion protein ORF7a (residues 18 to 95) produced in E. coli.
- Antigen Sequence
- MYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQE
- Specificity
- In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Transfected cells +++ ND ND ND ND -
Anti-ORF7a Ab at 1/2,500 dilution using HEK293 transfected cell lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
Anti-ORF7a Ab at 1/2,500 dilution; lane with 30 ng of recombinant fusion protein; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping