Anti-Asense

(0) Reviews

(0) References

(0) Validations

(0) Q&A

Catalog #: AB0383
Category: Antibodies
Family: Insect
Source: Goat
Application: WB, IF
Reactivity: Fruit fly
Description: Asense protein is a Drosophila neural precursor gene that is capable of initiating sense organ formation.
Alternative names: AS-C T8, AS-C T8ase, as-T8, AS-T8, ASC, ascT8, Ase, bHLHc28, CG3258; Dmel\CG3258, EG:165H7.2, sc/T8, T1, T1a, T1A, T8 antibody.
Gene Identifier/Accession#: Gene ID: 30985
Form: Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 254 aa to the C-terminus of Asense produced in E. coli.
Antigen Sequence: DCLDEHFDDSLSNYEMDEQQTVQQTLSEDMLNPPQASDLLPSLTTLNGLQYIRIPGTNTYQLLTTDLLGDLSHEQKLEETAASGQLSRSPVPQKVVRSPCSSPVSPVASTELLLQTQTCATPLQQQVIKQEYVSTNISSSSNAQTSPQQQQQVQNLGSSPILPAFYDQEPVSFYDNVVLPGFKKEFSDILQQDQPNNTTAGCLSDESMIDAIDWWEAHAPKSNGACTNLSV
Specificity: Detects endogenous levels of Asense by IF.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:2,000
IF	1:100-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Fruit fly	+++	ND	ND	+++	ND

Images

	Anti-Asense Ab at 1/1,000 dilution; protein at 40 ng per lane; chicken polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence – anti-Asense Ab in fly cells at 1/1000 dilution; InsGAL4 UASCD8 GFP wandering L3; cells were fixed with 4% of PFA;
	Immunofluorescence – anti-Asense Ab in fly cells at 1/1000 dilution; InsGAL4 UASCD8 GFP wandering L3; cells were fixed with 4% of PFA;
	Immunofluorescence – anti-Asense Ab in fly cells at 1/1000 dilution; InsGAL4 UASCD8 GFP wandering L3; cells were fixed with 4% of PFA;