Anti-NSP8 (SARS-CoV-2)
- Catalog #
- AB0391
- Category
- Antibodies
- Family
- SARS-CoV-2 Virus
- Source
- Goat
- Application
- WB
- Reactivity
- Transfected cells
- Description
- Nsp8 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein, complexed with Nsp7 may participate in viral replication by acting as a primase.
- Alternative names
- Nsp8 SARS Coronavirus-2 antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Affinity purified recombinant fusion protein Nsp8 produced in E. coli.
- Antigen Sequence
- MRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
- Specificity
- In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Transfected cells +++ ND ND ND ND -
Anti-NSP8 Ab at 1/2,500 dilution; lane with 30 ng of recombinant fusion protein; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping