Anti-TrioL
- Catalog #
- AB0403
- Category
- Antibodies
- Family
- Kinases and Phosphatases
- Source
- Goat
- Application
- None
- Reactivity
- Xenopus
- Description
- TrioL goat antibody. TRIO and F-actin binding protein L homeolog protein is involved in regulation of actin cytoskeletal organization.
- Alternative names
- triobp.L, MGC83528 antibody
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Affinity purified fusion recombinant protein using the C-terminal TrioL (residues 1,654 aa - stop) from Xenopus and produced in E. coli.
- Antigen Sequence
- LLSGVSPFLDESVEETCLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQGEQTKRPSAAVCLQEQWLQPGQHKSSGTLDMSRLTSFIERRK HQNDVRPIGSIKNFLQSRLLPRI
- Specificity
- In lysates of transfected cells with the plasmid containing the sequence used, detects the fusion protein by Western blot.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- Avoid freeze/thaw cycles.
-
Sample WB IHC (F) IHC (P) IF ELISA Xenopus +++ ND ND ND ND -
Anti-TrioL Ab at 1/2,500 dilution; lane with 30 ng of recombinant fusion protein; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Reactivity Chart
Images
375 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping