Anti-CD2
- Catalog #
- AB240241
- Category
- Antibodies
- Family
- CD Markers
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to CD2. This protein is a surface antigen found on all peripheral blood T-cells and is involved on antigen presenting cells to optimize immune recognition by interacting with LFA3 (CD58).
- Alternative names
- LFA-2, SRBC, T11, antibody.
- Gene Identifier/Accession#
- Gene ID: 914, ENSG00000116824
- Form
- Polyclonal antibody supplied as a 100 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 4.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli.
- Antigen Sequence
- MHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN
- Specificity
- Detects endogenous levels of CD2 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Canine +++ ND ND ND ND Monkey +++ ND ND ND ND -
Anti-CD2 Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
400 µg
Add to shopping cart
Shipping
No Shipping