Anti-Vimentin
- Catalog #
- AB252253
- Category
- Antibodies
- Family
- Structural proteins
- Source
- Goat
- Application
- WB, IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Vimentin. VIM is a member of the intermediate filament family. The cytoskeleton is made by these intermediate filaments, along with actin microfilaments and microtubules. VIM is responsible for integrity of the cytoplasm, stabilization of the cytoskeletal interactions and maintaining cell shape. This protein controls the transport of LDL-derived cholesterol from a lysosome to the site of esterification and is also involved in the immune response. It functions as an organizer of a number of critical proteins involved in migration, attachment and cell signaling.
- Alternative names
- CTRCT30, Epididymis luminal protein 113, FLJ36605, HEL113, VIM antibody
- Gene Identifier/Accession#
- Gene ID: 7431, ENSG00000026025
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 390 aa to the C-terminus of human VIM produced in E. coli.
- Antigen Sequence
- ALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
- Specificity
- Detects endogenous levels of VIM by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 IF 1:100-1:500 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND +++ ND Rat +++ ND ND +++ ND Mouse +++ ND ND +++ ND Canine +++ ND ND +++ ND Monkey +++ ND ND +++ ND -
Immunofluorescence – anti-VIM Ab in primary hCEC cells at 1/250 dilution; cells were fixed with methanol; 
Anti-VIM Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
Immunofluorescence – anti-VIM Ab in primary hCEC cells at 1/250 dilution; cells were fixed with methanol;
Usage
Reactivity Chart
External References (1)
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping