Anti-tdTomato
- Catalog #
- AB7358
- Category
- Antibodies
- Family
- Fluorescent Proteins
- Source
- Goat
- Application
- WB, IHC (F), IHC (P), IF, IEM
- Reactivity
- Transfected cells
- Description
- Goat polyclonal antibody to tdTomato (red fluorescent protein). tdTomato protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma. It is a genetic fusion of two copies of the dTomato gene, which has been specifically designed for low aggregation. It is a ~54 kDa protein that is optimally excited at a 554 nm and has a maximum of emission at 581 nm. It´s brightness and emission wavelength, makes it ideal for live animal research.
- Alternative names
- Cherry fluorescent protein; DsRed, mCherry, red fluorescent protein, RFP antibody.
- Gene Identifier/Accession#
- N/A
- Form
- Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in NaHCO3 100 mM pH 9. This antibody is epitope-affinity purified from goat antiserum and does not contain preservatives.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide produced in E. coli.
- Antigen Sequence
- MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK
- Specificity
- In 293HEK cells transfected with cds plasmid detects a band of 54 kDa by Western blot. It also detects tdTomato in brain sections by IHC. This antibody is specific for tdTomato and mCherry proteins. It does not cross-react to GFP (green fluorescent protein).
- Storage
- Store at -20 C for long-term storage.
- Special instructions
- N/A
-
Application Values WB 1:500-1:5,000 IHC (F) 1:50-1:500 IHC (P) 1:50-1:500 IF 1:50-1:500 IEM 1:50-1:500 -
Sample WB IHC (F) IHC (P) IF ELISA IEM Transfected cells +++ +++ +++ +++ ND +++ -
Immunofluorescence – anti-tdTomato Ab using hCEC cells transduced with tdTomato-CAV1; cells were fixed with methanol and anti-tdTomato at 1/250; 
Anti-tdTomato Ab at 1/2,500 dilution using HEK293 transfected cell lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
Immunofluorescence – anti-tdTomato Ab using hCEC cells transduced with tdTomato-CAV1; cells were fixed with methanol and anti-tdTomato at 1/250;
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
400 µg
Add to shopping cart
Shipping
No Shipping