Anti-mCherry

(0) Reviews

(0) References

(0) Validations

(0) Q&A

Catalog #: AB9770
Category: Antibodies
Family: Fluorescent Proteins
Source: Chicken
Application: WB, IF, ELISA
Reactivity: Transfected cells
Description: Chicken polyclonal antibody to mCherry (Cherry fluorescent protein).
Alternative names: Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.
Gene Identifier/Accession#: N/A
Form: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. Affinity purified using the immunogen immobilized on a solid support; Sample purity >95% (SDS-PAGE).
Concentration: 2.00 mg/ml
Isotype: IgY
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Affinity purified recombinant Red Fluorescent Protein (mCherry).
Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK
Specificity: This antibody recognizes a single band with predicted molecular weight in Western blot analysis.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Transfected cells	+++	ND	ND	+++	+++

Images

	Immunofluorescence – Mice brain transduced with AAV with Cre-dependent expression of mCherry. Free-floating slices fixed with 4% of PFA. Ab at 1/1,000 dilution; Courtesy of Rodrigues, Univ Minho;
	Anti-mCherry Ab at 1/15,000 dilution; 0.05 µg, 0.1 µg and 0.5 µg of purified recombinant mCherry; rabbit polyclonal to chicken IgY (HRP) at 1/10,000 dilution;
	Immunofluorescence – anti-mCherry Ab (AB9770) using hCEC cells transduced with mCherry-Rab5a; cells were fixed with methanol and mCherry Ab at 1/250; 2nd Ab goat anti-IgY (AB307405) at 1:1,000;
	Immunofluorescence – anti-mCherry Ab (AB9770) using hCEC cells transduced with mCherry-Rab5a; cells were fixed with methanol and mCherry Ab at 1/250; 2nd Ab goat anti-IgY (AB307405) at 1:1,000;