-
Catalog #
-
P2224
-
Category
-
Proteins
-
Family
-
Recombinant Proteins
-
Application
-
Electrophoresis
-
Reactivity
-
None
-
Description
-
GST (glutathione S-transferase) is a 26 KDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in GST plasmid expression vectors, including pGEX family. This DNA sequence integrated into expression vectors is used for production of recombinant proteins.
-
Alternative names
-
Glutathione S Transferase
-
Gene Identifier/Accession#
-
P08515
-
Form
-
Recombinant GST protein supplied as a 100, 200 or 500 µl (1 mg/ml) aliquot in phosphate buffer (0.1 M, pH 7.4).
-
Concentration
-
1.00 mg/ml
-
Tag
-
GST
-
Expression System
-
Prokaryotic Cells (E. coli)
-
Antigen Sequence
-
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFPGRLERPHR
-
Specificity
-
N/A
-
Storage
-
Store at -80 C for long-term storage.
-
Special instructions
-
Avoid freeze/thaw cycles.
-
|
Application
|
Values
|
|
Electrophoresis
|
|