Anti-CX43

(0) Reviews

(2) References

(0) Validations

(0) Q&A

Catalog #: AB0015
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to connexin 43, which is a member of the connexin family. Cx43 is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. This protein is the major protein of gap junctions in embryonic development and in the heart that are thought to have a crucial role in the synchronized contraction of the heart.
Alternative names: AVSD3, CX43, DFNB38, gap junction protein, alpha 1, 43kDa, GJA1, GJAL HSS, HLHS1, ODDD antibody.
Gene Identifier/Accession#: Gene ID: 2697, ENSG00000152661
Form: Polyclonal antibody supplied as a 200 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 4.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.
Antigen Sequence: VKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Specificity: Detects endogenous levels of total connexin 43.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:2,000
IF	1:50-1:250
IHC (P)	1:250-1:800
IHC (F)	1:250-1:800

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (2)

Yu X, He W, Xie J, et al. J Cardiovasc Electrophysiol. 2018 Dec	PMID: 30516302
Xing J, Wang H, Chen L, et al. Int Immunopharmacol 2022	PMID: 36442284

Images

	Immunostaining of primary RPE cells with CX43 Ab at 1/100 dilution;
	Endogenous Cx43 detected at 1/1,000 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;