Anti-CX43

(0) Reviews

(10) References

(0) Validations

(0) Q&A

Catalog #: AB0016
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to connexin 43, which is a member of the connexin family. Cx43 is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. This protein is the major protein of gap junctions in embryonic development and in the heart that are thought to have a crucial role in the synchronized contraction of the heart.
Alternative names: AVSD3, CX43, DFNB38, gap junction protein, alpha 1, 43kDa, GJA1, GJAL HSS, HLHS1, ODDD antibody.
Gene Identifier/Accession#: Gene ID: 2697, ENSG00000152661
Form: Polyclonal antibody supplied as a 200 or 500 µl (4 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide.
Concentration: 4.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.
Antigen Sequence: VKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Specificity: Detects endogenous levels of total connexin 43.
Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:500-1:2,000
IF	1:50-1:250
IHC (P)	1:250-1:800
IHC (F)	1:250-1:800

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (10)

Ribeiro-Rodrigues TM, Catarino S, Marques C, et al. FASEB J 2014 Nov	PMID: 25070368
Martins-Marques T, Anjo SI, Pereira P, et al. Mol Cell Proteomics 2015 Aug	PMID: 26316108
Ferreira RRS, MSc Thesis, University of Coimbra, Portugal, 2015
Paiva RA, MSc Thesis, University of Coimbra, Portugal, 2015
Martins-Marques T, Pinho MJ, Zuzarte M. et al. J Extracell Vesicles. 2016 Sep	PMID: 27702427
Barbeitos JP, MSc Thesis, University of Coimbra, Portugal 2018
Wang W, Ye S, Zhang L, et al. BMC Cardiovasc Disord 2020	PMID: 32066388
Catarino S, Ribeiro-Rodrigues TM, Sa Ferreira R, et al. Cells 2020 Apr.	PMID: 32272685
Lissoni A, Hulpiau P, Martins-Marques T, et al. Cardiovasc Res. 2021 Jan	PMID: 31841141
Martins-Marques T, Costa MC, Catarino S, et al. EMBO Rep 2022 May	PMID: 35593040

Images

	Immunostaining of primary RPE cells with CX43 Ab at 1/100 dilution;
	IHC of human skin using CX43 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CX43 Ab at 1:500/DAB detection;
	Endogenous CX43 detected at 1/1,000 dilution; lysate at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse brain using anti-CX43 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CX43 Ab at 1:500/DAB detection;
	Immunostaining of COS7 cells with CX43 Ab at 1/250 dilution and Dylight 550;
	IHC of mouse pancreas using anti CX43 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CX43 Ab at 1:500/DAB detection;
	IHC of mouse lung using anti-CX43 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CX43 Ab at 1:500/DAB detection;
	IHC of mouse spleen using CX43 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-CX43 Ab at 1:500/DAB detection;