Anti-Rab1b
- Catalog #
- AB0017
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Rab1b. Rab1b belongs to the small GTPase superfamily, Rab family. Rab1b together with Rab1a control vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.
- Alternative names
- RAB1A, RAB1B, RAS-associated protein RAB1A, ras-related protein Rab-1B, ras-related protein Rab-1A, ras-related protein Rab-1B, YPT1 antibody.
- Gene Identifier/Accession#
- Gene ID: 81876, ENSG00000174903
- Form
- Polyclonal antibody supplied as a 100 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli.
- Antigen Sequence
- QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC
- Specificity
- Detects endogenous levels of Rab1b protein by Western blot in whole cell lysates and transfected cells with GFP-Rab1b cds.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:5,000 IHC (F) 1:100-1:500 IHC (P) 1:100-1:500 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
Anti-Rab1b Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human muscle using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab1b Ab at 1:250/DAB detection. 
IHC of mouse intestine using anti Rab1b antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab1b Ab at 1:250/DAB detection. 
IHC of human skin using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab1b Ab at 1:250/DAB detection. 
IHC of human skin using anti-Rab1b antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab1b Ab at 1:250/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
300 µg
Add to shopping cart
Shipping
No Shipping