Anti-Rab20
- Catalog #
- AB0022
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to RAB20. RAB20 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein localizes to Golgi apparatus and plays a role in apical endocytosis/recycling.
- Alternative names
- Ras-related protein Rab-20 antibody.
- Gene Identifier/Accession#
- ENSG00000139832, Gene ID: 55647
- Form
- Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 130 aa to the C-terminus of Rab20 produced in E. coli.
- Antigen Sequence
- MEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
- Specificity
- Detects Rab20 in transfected cells with GFP-Rab20 by Western blot. Detects levels of endogenous Rab20 (testis, liver and kidney) by Western blot.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:250-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Canine +++ ND ND ND ND Monkey +++ ND ND ND -
Anti-Rab20 Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
300 €
Quantity / Unit Size
400 µg
Add to shopping cart
Shipping
No Shipping