Anti-Rab5c
- Catalog #
- AB0024
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Rab5c. Rab5c belongs to the small GTPase superfamily, Rab family. Rab5c is an Early Endosome Marker and functions as a key regulator of vesicular trafficking during early endocytosis.
- Alternative names
- L1880, RAB5C, RAS-associated protein RAB5C, ras-related protein Rab-5C, Rab5L antibody.
- Gene Identifier/Accession#
- ENSG00000108774, Gene ID: 5878
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 118 aa to the C-terminus of mouse Rab5c produced in E. coli.
- Antigen Sequence
- ELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN
- Specificity
- Detects Rab5c by Western blot in the following human, rat and mouse whole cell lysates and transfected cells with GFP-Rab5c. This antibody is specific for Rab5c. It does not recognize Rab5a and Rab5b proteins.
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:250-1:2,000 IHC (F) 1:200-1:750 IHC (P) 1:200-1:750 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of human placenta using anti-Rab5c antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab5c Ab at 1:500/DAB detection. 
Anti-Rab5c Ab at 1/500 dilution; lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of rat eye using anti-Rab5c antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab5c Ab at 1:500/DAB detection. 
IHC of human placenta using anti-Rab5c antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab5c Ab at 1:500/DAB detection.
Usage
Reactivity Chart
External References (1)
Images
320 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping