Anti-Rab3a
- Catalog #
- AB0032
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Rab3a. Rab3a belongs to the small GTPase superfamily, Rab family. Rab3a is involved in exocytosis by regulating a late step in synaptic vesicle fusion. It plays a role in neurotransmitter release by regulating membrane flow in the nerve terminal.
- Alternative names
- RAB3A, RAS-associated protein RAB3A, ras-related protein Rab-3A antibody.
- Gene Identifier/Accession#
- Gene ID: 5864, ENSG00000105649
- Form
- Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 2.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Recombinant peptide derived from within residues 181 aa to the C-terminus of Rab3a produced in E. coli.
- Antigen Sequence
- EFMSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC
- Specificity
- Detects endogenous levels of Rab3a by Western blot. It does not cross-react with Rab3b, Rab3c and Rab3c.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:1,000-1:2,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
Anti-Rab3a Ab at 1/1,000 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human pancreas using anti-Rab3a antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab3a Ab at 1:750/DAB detection; 
IHC of mouse brain using anti-Rab3a antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab3a Ab at 1:750/DAB detection; 
IHC of mouse retina using anti-Rab3a antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab3a Ab at 1:750/DAB detection; 
IHC of mouse testis using anti-Rab3a antibody and FFPE tissue after heat-induced antigen retrieval. Anti-Rab3a Ab at 1:750/DAB detection;
Usage
Reactivity Chart
External References (1)
Images
375 €
Quantity / Unit Size
200 µg
Add to shopping cart
Shipping
No Shipping