Anti-Rab25

(0) Reviews

(1) References

(0) Validations

(0) Q&A

Catalog #: AB0035
Category: Antibodies
Family: Vesicle Trafficking
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: RAB25 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. Members of the RAB11 subfamily, including RAB25, control the return of internalized membrane-associated moieties to the cell surface.
Alternative names: CATX-8, RAB11C antibody.
Gene Identifier/Accession#: Gene ID: 57111, ENSG00000132698
Form: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 2.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab25 produced in E. coli.
Antigen Sequence: MIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAITLGNAQAGQDPGPGEKRACCISL
Specificity: Detects Rab25 by Western blot in transfected cells with GFP-Rab25.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (1)

Images

	IHC of mouse kidney using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	Immunofluorescence – anti-Rab25 Ab in Hepa1-6 cells at 1/50 dilution; methanol fixation;
	IHC of mouse intestine using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	Anti-Rab25 Ab at 1/1,000 dilution; HEK293 cells transfected with GFP-Rab25; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	IHC of mouse liver using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	IHC of rat brain using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	IHC of human breast cancer using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	IHC of human tonsil using anti-Rab25 antibody and FFPE tissue after heat-induced antigen retrieval; Anti-Rab25 Ab at 1:750/DAB detection;
	Anti-Rab25 antibody IHC staining of mammary tissue; Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; antibody concentration 1/200;