Anti-Rab27a

(0) Reviews

(4) References

(0) Validations

(0) Q&A

Catalog #: AB0045
Category: Antibodies
Family: Vesicle Trafficking
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal antibody to mouse Rab27a. Rab27a belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and involved in lysosome-related vesicle transport and small GTPase mediated signal transduction.
Alternative names: GS2, GTP-binding protein Ram, rab-27, ras-related protein Rab-27A, RAB27, RAM.
Gene Identifier/Accession#: Gene ID: 5873, ENSG00000069974
Form: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 2.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a produced in E. coli.
Antigen Sequence: MHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSTDQLSEEKEKGLCGC
Specificity: Detects Rab27a by Western blot in the following human, rat and mouse whole cell lysates and transfected cells with GFP-Rab27a. This antibody is specific for Rab27a. It does not recognize Rab27b protein.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Application	Values
WB	1:250-1:2,000
IF	1:50-1:200
IHC (P)	1:50-1:400
IHC (F)	1:50-1:400

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (4)

Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018
Domingues L, Hurbain I, Gilles-Marsens F, et al. bioRxiv 2019
Domingues L, Hurbain I, Gilles-Marsens F, et al. Nat Commun 2020 Jun	PMID: 32532976
Ramsay E, Ravina M, Sarkhel S, et al. Pharmaceutics 2020 Jul	PMID: 32708811

Images

	Anti-Rab27a antibody IHC staining of mammary tissue; immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; antibody concentration 1/200;
	Anti-Rab27 Ab at 1/500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Anti-Rab27a antibody IHC staining of mouse stomach; immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval; Antibody concentration 1/200;