Anti-ZO1

(0) Reviews

(2) References

(0) Validations

(0) Q&A

Catalog #: AB0054
Category: Antibodies
Family: Organelle Markers
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to TJP1 tight junction protein 1 (TJP1). TJP1 is located on a cytoplasmic membrane surface of intercellular tight junctions and may be involved in signal transduction at cell-cell junctions.
Alternative names: ZO-1 and zona occludens protein 1 antibody.
Gene Identifier/Accession#: Gene ID: 7082, ENSG00000104067
Form: Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.
Antigen Sequence: PQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF
Specificity: Detects endogenous levels of total ZO1 by Western blot in whole cell and tissue lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.

Usage

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat	+++	+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND

External References (2)

Pelkonen L, Sato K, Reinisalo M, et al. Mol Pharm. 2017 Mar 6. Suplemental Material.	PMID: 28112518
Cardoso MHS, PhD Thesis, NOVA University of Lisbon, Portugal 2018

Images

	Immunofluorescence of primary RPE cells with ZO1 Ab at 1/100 dilution;
	Anti-ZO1 Ab at 1/2,500 dilution; 50 µg of total protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence of primary RPE cells with ZO1 Ab at 1/100 dilution;
	IHC of human pancreas using ZO1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ZO1 Ab at 1:750/DAB detection.
	Immunofluorescence of primary RPE cells with ZO1 Ab at 1/100 dilution;
	IHC of human pancreas using ZO1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ZO1 Ab at 1:750/DAB detection.
	Immunofluorescence of primary RPE cells with ZO1 Ab at 1/100 dilution;
	IHC of mouse kidney using ZO1 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ZO1 Ab at 1:750/DAB detection.
	Immunofluorescence of primary RPE cells with ZO1 Ab at 1/100 dilution;
	Immunoperoxidase of polyclonal antibody to ZO1 (1/200) on paraformaldehyde-fixed paraffin-embedded mouse kidney;