Anti-Rab9a
- Catalog #
- AB0056
- Category
- Antibodies
- Family
- Vesicle Trafficking
- Source
- Goat
- Application
- WB
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to Rab9a. Rab9a belongs to the small GTPase superfamily, Rab family. This protein may be involved in endosome-to-Golgi transport.
- Alternative names
- RAB9, RAB9A, member RAS oncogene family, ras-related protein Rab-9A antibody.
- Gene Identifier/Accession#
- Gene ID: 9367, ENSG00000123595
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 115 aa to the C-terminus of Rab9a produced in E. coli.
- Antigen Sequence
- QNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQAWCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPKPNSSCC
- Specificity
- Rab9a antibody detects endogenous levels of Rab9a protein and transfected cells with GFP-Rab9a cds.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:250-1:2,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND ND ND Rat +++ ND ND ND ND Mouse +++ ND ND ND ND Canine +++ ND ND ND ND Monkey +++ ND ND ND ND -
Anti-Rab9a Ab at 1/500 dilution; 3T3 NIH cell line lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
Usage
Reactivity Chart
Images
375 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping