Anti-P53
- Catalog #
- AB0065
- Category
- Antibodies
- Family
- Cancer
- Source
- Goat
- Application
- WB, IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to P53. This protein reacts to diverse cellular stresses to regulate target genes that induce apoptosis, senescence, cell cycle arrest, DNA repair, or changes in metabolism. p53 is a DNA-binding protein containing transcription activation, DNA-binding, and oligomerization domains. It is assumed to bind to a p53-binding site and activate expression of downstream genes that inhibit growth and/or invasion, and thus function as a tumour suppressor.
- Alternative names
- BCC7, LFS1 and TRP53 antibody.
- Gene Identifier/Accession#
- ENSG00000141510, Gene ID: 7157
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
- Antigen Sequence
- DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
- Specificity
- Detects endogenous levels of P53 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use. Avoid freeze/thaw cycles.
-
Application Values WB 1:500-1:2,000 IF 1:50-1:250 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND +++ ND Rat +++ ND ND +++ ND Mouse +++ ND ND +++ ND Canine +++ ND ND +++ ND Monkey +++ ND ND +++ ND -
Anti-P53 Ab at 1/2,500 dilution; lysates at 50 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
Immunofluorescence – anti-P53 Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with methanol;
Usage
Reactivity Chart
External References (1)
Images
320 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping