Anti-GAPDH

(0) Reviews

(14) References

(0) Validations

(0) Q&A

Catalog #: AB0067
Category: Antibodies
Family: Loading Controls
Source: Goat
Application: WB, IHC (F), IHC (P), IF
Reactivity: Human, Rat, Mouse, Monkey, Canine
Description: Goat polyclonal to GAPDH (glyceraldehyde 3-phosphate dehydrogenase). GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains.
Alternative names: glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, G3PD, GAPD, HGNC:4141, GAPDH antibody.
Gene Identifier/Accession#: Gene ID: 2597, ENSG00000111640
Form: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 2.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli.
Antigen Sequence: SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Specificity: Detects a band of 37 kDa by Western blot in the following human (293A, HMEC-1, U-118, HaCat), rat (TR-iBRB), mouse (AtT-20, Hepa), canine (D17) and monkey (COS-7) whole cell lysates.
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:10,000
IF	1:50-1:250
IHC (P)	1:200-1:1,000
IHC (F)	1:200-1:1,000

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA
Human	+++	+++	+++	+++	ND
Rat		+++	+++	+++	ND
Mouse	+++	+++	+++	+++	ND
Monkey	+++	+++	+++	+++	ND
Canine	+++	+++	+++	+++	ND

External References (14)

Matos CTSM, PhD Thesis, NOVA University of Lisbon, Portugal, 2013
Grilo MLJ, MSc Thesis, University of Coimbra, Portugal, 2014
Helsby MA, Leader PM, Fenn JR. BMC Cell Biol. 2014 Feb	PMID: 24528853
Hyenne V, Apaydin A, Rodriguez D, et al. J Cell Biol. 2015 Oct	PMID: 26459596
Gonçalves A, Lin CM, Muthusamy A, et al. Invest Ophthalmol Vis Sci. 2016 May	PMID: 27163772
Firouzi F, MSc Thesis, San Diego State University, USA, 2017
Khalafalla FG, Kayani W, Kassab A, et al. J Physiol. 2017 Oct	PMID: 28980705
Sacchi V, Wang BJ, Kubli D, et al. J Am Heart Assoc. 2017 Oct (Supplemental Information)	PMID: 29018025
Choudhury SS, MSc Thesis, Univ San Diego, USA, 2018
Korski KI,MSc Thesis, Univ San Diego, USA, 2018

Images

	Anti-GADPH Ab at 1/1,000 dilution; lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence – anti-GAPDH Ab in Hepa1-6 cells at 1/50 dilution; cells were fixed with methanol;