Anti-CDH2
- Catalog #
- AB0071
- Category
- Antibodies
- Family
- Organelle Markers
- Source
- Goat
- Application
- WB, IF
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal to CDH2. CDH2 is a classical member of the cadherin superfamily. This protein is a calcium dependent cell-cell adhesion glycoprotein comprised consists of 5 cadherin repeats in the extracellular domain, one trans membrane domain, and a highly conserved intracellular domain. It has been shown to play an essential role in normal neuronal development, which is implicated in an array of processes including neuronal differentiation, migration, axon growth and fasciculation.
- Alternative names
- cadherin 2, cadherin-2, CD325, CDHN, CDw325, CDH2, NCAD, N-cadherin, N-cadherin 1, neural cadherin, neural-cadherin, neural cadherin (NCAD) antibody.
- Gene Identifier/Accession#
- Gene ID: 1000, ENSG00000170558
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 850 aa to C-terminus of human CDH2 produced in E. coli.
- Antigen Sequence
- VFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
- Specificity
- Detects endogenous levels of total N-cadherin protein by Western blot in the whole cell lysates (COS-7, HeLa, HUH and Hepa-6).
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:2,000 IF 1:25-1:250 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ ND ND +++ ND Rat +++ ND ND +++ ND Mouse +++ ND ND +++ ND Canine +++ ND ND +++ ND Monkey +++ ND ND +++ ND -
N-Cadherin antibody marking the intercalated disks (distal cell junctions in heart tissue – green line in the middle) of Human iPS-derived cardiomyocytes; Methanol fixation; DAPI: DNA (nuclear) stain, SARC aAct: Sarcomeric a-Actinin, N-CAD: N-Cadherin This image is courtesy of Dr Zanella F (University of California) 
Endogenous CDH2 detected with at 1/500 dilution; lysates at 100 µg per lane and rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution.
Usage
Reactivity Chart
Images
300 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping