Anti-mCherry

(0) Reviews

(48) References

(0) Validations

(0) Q&A

Catalog #: AB0081
Category: Antibodies
Family: Fluorescent Proteins
Source: Goat
Application: WB, IHC (F), IHC (P), IF, IEM
Reactivity: Transfected cells
Description: Goat polyclonal antibody to mCherry (Cherry fluorescent protein). mCherry protein is derived from DsRed, an engineered red fluorescent protein from so-called disc corals of the genus Discosoma.
Alternative names: Cherry fluorescent protein; dsRed, red fluorescent protein, tdTomato antibody.
Gene Identifier/Accession#: N/A
Form: Polyclonal antibody supplied as a 200 or 500 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration: 3.00 mg/ml
Isotype: IgG
Clonality: Polyclonal
Conjugation: Unconjugated
Immunogen: Purified recombinant peptide produced in E. coli.
Antigen Sequence: MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSNGGMDEVYK
Specificity: In 293HEK cells transfected with cds plasmid detects a band of 29 kDa by Western blot. This antibody (AB0081) recognizes very well tdTomato and does not cross-react to GFP (green fluorescent protein).
Storage: For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
Special instructions: The antibody solution should be gently mixed before use.

Usage

Application	Values
WB	1:500-1:5,000
IF	1:50-1:500
IHC (P)	1:50-1:500
IHC (F)	1:50-1:500
IEM	1:50-1:500

Reactivity Chart

Sample	WB	IHC (F)	IHC (P)	IF	ELISA	IEM
Transfected cells	+++	+++	+++	+++	ND	+++

External References (48)

Sofer Y, Zilkha N, Gimpel E, et al. Nat Neurosci 2024 Jul	PMID: 38969756
Bourhy L, Moigneu C, Dupin A, et al. bioRxiv, 2024
Ackmann J, Brüge A, Gotina L, et al. Cell Commun Signal 2024 Apr	PMID: 38641599
Cai Y, Zhao Z, Shi M, et al. bioRxiv, 2024
Kaneko T, Oura A, Imai Y, et al. Commun Biol 2024 Mar	PMID: 38459114
Yue W, Touhara K, Toma K, et al. bioRxiv, 2024
Do JL, Pedroarena-Leal N, Louie M, et al. Invest Ophthalmol Vis Sci 2023 Dec	PMID: 38117244
Ohno-Shosaku T, Yoneda M, Maejima T, et al. Neuroscience 2023 Sep	PMID: 37778689
Jagot F, Gaston-Breton R, Choi AJ, et al. Neuron 2023 Aug	PMID: 37279750
Xu J, Deng X, Gu A, et al. Cell Rep 2023 Jun	PMID: 37352102

Images

	Immunofluorescence in Drosophila larvae NMJ muscle 6/7 expressing mCherry in neurons (DyGlutmCherry) using 1st Ab anti-mCherry at 1/1,000 and 2nd Ab anti-goat IgY conjugated to DyLight®488 at 1/500;
	Immunogold labeling of RPE, in vivo injected with mCherry expressing vector;
	nti-mCherry Ab at 1/1,000 dilution; 293HEK cells transduced with myc-mCherry Ad; lysates at 100 µg per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution;
	Immunofluorescence – anti-mCherry Ab in 293HEK cells transfected with mCherry-Rab1a at 1/50 dilution; cells were fixed with 4% of PFA;