Anti-ERBB2
- Catalog #
- AB0088
- Category
- Antibodies
- Family
- Cancer
- Source
- Goat
- Application
- WB, IHC (F), IHC (P)
- Reactivity
- Human, Rat, Mouse, Monkey, Canine
- Description
- Goat polyclonal antibody to ERBB2. This protein is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases containing a single transmembrane domain and has an approximate molecular weight of 185 kDa. ERBB2 contains no ligand binding domain and interacts with other EGF receptor family members to form a heterodimer, stabilize ligand binding, and enhance kinase-mediated downstream signalling. It has been shown to be involved in embryonic development and cancer progression.
- Alternative names
- CD340, erb-b2 receptor tyrosine kinase 2, HER2, HER-2, HER-2/neu, MLN 19, NEU, NGL and TKR1 antibody.
- Gene Identifier/Accession#
- Gene ID: 2064, ENSG00000141736
- Form
- Polyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
- Concentration
- 3.00 mg/ml
- Isotype
- IgG
- Clonality
- Polyclonal
- Conjugation
- Unconjugated
- Immunogen
- Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli.
- Antigen Sequence
- MPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
- Specificity
- Detects endogenous levels of ERBB2 by Western blot.
- Storage
- For continuous use, store at 2-8 C for one-two days. For extended storage, store in -20 C freezer. Working dilution samples should be discarded if not used within 12 hours.
- Special instructions
- The antibody solution should be gently mixed before use.
-
Application Values WB 1:500-1:5,000 IHC (F) 1:250-1:1,000 IHC (P) 1:250-1:1,000 -
Sample WB IHC (F) IHC (P) IF ELISA Human +++ +++ +++ ND ND Rat +++ +++ +++ ND ND Mouse +++ +++ +++ ND ND Canine +++ +++ +++ ND ND Monkey +++ +++ +++ ND ND -
IHC of human breast carcinoma using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection. 
Anti-ERBB2 Ab at 1:2,500 dilution; 50 µg of total protein per lane; rabbit polyclonal to goat IgG (HRP) at 1/10,000 dilution; 
IHC of human appendix using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection. 
IHC of rat eye using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection. 
IHC of human placenta using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection. 
IHC of human skin using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection. 
IHC of mouse liver using anti-ERBB2 antibody and FFPE tissue after heat-induced antigen retrieval. Anti-ERBB2 Ab at 1:500/DAB detection.
Usage
Reactivity Chart
Images
320 €
Quantity / Unit Size
600 µg
Add to shopping cart
Shipping
No Shipping